This is a working overview of Deamidation, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-01-06. Anything still debated is marked as such rather than presented as settled.
Published evidence comes mainly from Russian-language journals and from a single research group, with small sample sizes and limited independent replication. A few laboratories outside that group have examined related peptides and reported weaker or absent telomerase effects, so the central claim is best described as contested rather than settled. Rodent studies report modest changes in some ageing markers and in survival, but designs vary and control conditions are often sparse. No large randomised trial in humans has been published, and long-term safety data in healthy populations are correspondingly thin.
Epitalon is a synthetic tetrapeptide with the sequence alanine-glutamate-aspartate-glycine, commonly abbreviated AEDG. It was designed at the St. Petersburg Institute of Bioregulation and Gerontology as a short, chemically defined analogue of epithalamin, a fraction obtained from bovine pineal tissue. Small peptide bioregulators of this type formed a long-running line of work there from the 1980s onward. Because the molecule is produced by solid-phase synthesis rather than extraction, its composition is exact and its purity can be measured directly.
The most frequently cited proposed action is induction of telomerase, the enzyme that adds repeat sequences to chromosome ends. Cell-culture work from the originating group reported higher telomerase reverse transcriptase expression and measurable telomere elongation in human somatic cells after exposure. How a four-residue peptide would reach nuclear gene regulation is not established, and no cell-surface receptor or uptake route has been identified. Additional reports describe changes in melatonin secretion, antioxidant enzyme activity and lipid peroxidation in aged animals, but these findings remain mechanistically unconnected to the telomerase observation.
Stability depends strongly on pH, temperature and the presence of oxygen and trace metals. Cleavage of the backbone proceeds faster under neutral to alkaline conditions, whereas acidic solutions tend to slow that reaction. The aspartate and glutamate side chains can undergo deamidation or imide formation over time, generating closely related impurities. Published stability data specific to epitalon are sparse, so the usable life of a given solution is best regarded as an open question that depends on buffer composition, concentration and storage temperature.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography with ultraviolet detection, frequently near 214 nanometers where the peptide bond absorbs. Mass spectrometry, most often with electrospray ionization, confirms the observed molecular mass and helps separate the intact peptide from truncated or modified forms. Amino acid analysis or tandem mass spectrometry can establish residue order. Purity is commonly quoted as an area percentage, yet such values are method-dependent, and comparisons between laboratories require matching column, gradient and detection wavelength.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C14H22N4O9 | Calculated from the four residues with three water losses |
| Molecular mass | About 390.35 g/mol | Monoisotopic mass near 390.14, used for mass-spectrometric identification |
| Peptide sequence | Ala-Glu-Asp-Gly | Single-letter form AEDG; no disulfide bonds or modified residues |
| Appearance | White to off-white solid | Supplied as a dried powder |
| Isoelectric point | Around 4 | Estimated from aspartate and glutamate side-chain pKa values |
Residue composition is the property that most cleanly separates verified material from mislabelled samples. Alanine, glutamate, aspartate and glycine appear in that order from the N-terminus, and the two acidic residues sit in the middle of the chain. Because the peptide is short, it can be produced by solid-phase synthesis and characterised by mass spectrometry without ambiguity. Any reported sample whose measured mass departs substantially from 390 daltons is a different compound or a degraded mixture rather than epitalon.
Epitalon is a synthetic tetrapeptide whose four residues are alanine, glutamate, aspartate and glycine, commonly abbreviated AEDG. Its molecular formula is C14H22N4O9 and its monoisotopic mass is near 390.35 daltons. The peptide carries two acidic side chains, so it is neutral to negatively charged in most aqueous buffers. Published reference summaries usually list it under both spellings, epitalon and epithalon, and treat the two names as the same material.
The most widely cited claim is that epitalon activates telomerase and thereby extends telomere length. Supporting evidence comes largely from cultured human cells, where treatment was associated with increased telomerase activity and delayed replicative senescence. Telomerase activation is a biologically consequential effect, since the enzyme is largely silenced in most somatic cells. However, the route by which a short peptide would reach and act on the enzyme's regulatory machinery has not been established. Independent replication in human trials is scarce, so the link between cell-culture observations and whole-body aging remains an open question.
Human data are limited to small studies, often without the randomization, blinding, or control groups expected in contemporary clinical research. Reported outcomes have included changes in melatonin levels, immune markers, and subjective measures, but sample sizes were generally too small to support firm conclusions. Some reviews treat the peptide as promising while noting methodological weaknesses; others question whether the observed effects are specific. The compound is frequently discussed in longevity-focused communities, where enthusiasm often outpaces the published evidence. Separating established findings from speculation is therefore important when reading summaries of this research.
The pathway starts with glycerol 3-phosphate, which gets converted to lysophosphatidate via the addition of a fatty acid chain provided by acyl coenzyme A. Then, lysophosphatidate is converted to phosphatidate via the addition of another fatty acid chain contributed by a second acyl CoA; all of these steps are catalyzed by the glycerol phosphate acyltransferase enzyme. Phospholipid synthesis continues in the endoplasmic reticulum, and the biosynthesis pathway diverges depending on the components of the particular phospholipid.
Braegen-02 is a small-molecule drug which acts as a potent and selective agonist of the tropomyosin receptor kinase B (TrkB). It is commonly referred to as CF3CN due to the CF3 and CN groups in its chemical structure, but this may cause confusion with the unrelated chemical trifluoroacetonitrile which has the chemical formula CF3CN. As with many TrkB agonists it was derived through modification of the natural product TrkB agonist 7,8-dihydroxyflavone, but it is more potent than earlier derivatives such as R13. It is under development as a potential treatment for neurodegenerative conditions such as Alzheimer's disease and Parkinson's disease.
==== Grafting through ==== Not like the grafting from and grafting to approach which can conjugate several polymers onto one protein core, the grafting through approach enables several proteins to connect to one polymer chain due to the multivalent nature of protein.
Experts agree that homemade ORS preparations should include one liter (34 oz.) of clean water and 6 tsp (30 mL) of sugar; however, they disagree about whether they should contain half a teaspoon of table salt or a full teaspoon. Most sources recommend using half a teaspoon of salt per liter of water. However, people with malnutrition have an excess of body sodium. To avoid worsening this symptom, ORS for people with severe undernutrition should contain half the usual amount of sodium and more potassium.
Sources: en.wikipedia.org
It is now known that organic compounds can be conductors, semiconductors, and insulators, thus one of the main opportunities in nanomaterials science is to use organic synthesis and molecular design to make electronically useful structures. Structural motifs in these systems include colloids, small crystals, and aggregates on the order of 1-100 nm. By function Nanostructured materials can also be classed according to their functions, for example nanoelectronics and information technology (IT). Lateral dimensions used in information storage are shrinking from the micro- to the nanoscale as fabrication technologies improve. Optical materials are important in the development of miniaturized information storage because light has many advantages for storage and transmission over electronic methods. Quantum dots - most commonly CdSe nanoparticles having diameters of tens of nm, and with protective surface coatings - are notable for their ability to fluoresce over a broad range of the visible spectrum, with the controlling parameter being size. By structure Certain structural classes are especially relevant to nanoscience. As the dimensions of structures become smaller, their surface area-to-volume ratio increases. Much like molecules, nanostructures at small enough scales are essentially "all surface". The mechanical properties of materials are strongly influenced by these surface structures. Fracture strength and character, ductility, and various mechanical moduli all depend on the substructure of the materials over a range of scales.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
King Crimson have been described musically as progressive rock, art rock, and post-progressive, with their earlier works being described as proto-prog. Their music was initially grounded in the rock of the 1960s, especially the acid rock and psychedelic rock movements. The band played Donovan's "Get Thy Bearings" in concert, and were known to play the Beatles' "Lucy in the Sky with Diamonds" in their rehearsals. However, for their own compositions, King Crimson (unlike the rock bands that had come before them) largely stripped away the blues-based foundations of rock music and replaced them with influences derived from classical composers. The first incarnation of King Crimson played the Mars section of Gustav Holst's suite The Planets live and later the band used Mars as a foundation for the song "Devil's Triangle". As a result of this influence, In the Court of the Crimson King is frequently viewed as the nominal starting point of the progressive rock movements. King Crimson also initially displayed strong jazz influences, especially on its signature track "21st Century Schizoid Man". The band also drew on English folk music for compositions such as "Moonchild" and "I Talk to the Wind". In the 1972 lineup, Fripp's intention was to combine the music of Jimi Hendrix, Igor Stravinsky and Béla Bartók. The 1981 reunion of the band brought in even more elements, displaying the influence of funk, post-punk, new wave, gamelan music and minimalist classical composers such as Philip Glass, Steve Reich and Terry Riley.
=== Fourth Republic === June 27, 1947: Decree creating the medical code of ethics; it includes provisions on therapeutic abortion. November 1947: Germaine Poinso-Chapuis becomes France's first female minister, for Public Health and Population; the second female minister in the country will be Simone Veil in 1974. November 5, 1947: Decree implementing the April 24, 1946, law establishing a sanitary and social registry of prostitution. September 1, 1948: Law modifying and codifying legislation on relations between landlords and tenants or occupants of residential or professional premises and establishing housing allowances. August 11, 1950: Law publishing ILO Convention No. 3 (adopted on November 29, 1919) and authorizing its ratification; this convention concerns the employment of pregnant and newly delivered women. October 15, 1951: Decree on the status of female military personnel. December 10, 1952: Law authorizing the ratification of ILO Convention No. 100, concerning "equal remuneration for men and women for work of equal value." May 17, 1954: Decree on the family record book: contents and definitions of the records and extracts to be included. August 6, 1955: Law setting the supplementary budget for agricultural family benefits for fiscal years 1955 and 1956; notably establishes a "housewife allowance," granted to the "head of household" under certain conditions. November 28, 1955: Decree on the medical code of ethics, modifying the previous one.
=== Nancy Bartlett === Nancy Lynn Bartlett is played by Sandra Bernhard. Nancy is a part owner of the Lanford Lunch Box. She marries Arnie Thomas, but — after he eventually leaves her — she comes out as a lesbian. She frequently is seen dating women; her first girlfriend Marla is played by Morgan Fairchild. Nancy is never ashamed of her promiscuity, nor does she ever show any self-consciousness about her unusual behavior. She is one of the most self-confident characters in the series, often even more than Roseanne. Her tendency toward self-absorption seems to only be quelled while dating a woman or being around Jackie. Nancy turns out to be a loyal good friend to both Roseanne and Jackie throughout the series; however, she doesn't hesitate to reprimand them for their selfishness and cruelty when they treat their mother, Bev, so harshly that Bev ends up crying about it for days afterward while Nancy gives her support. Nancy appeared in a revival-era episode in 2018 in season 10, but did not appear on The Conners.
Sources: en.wikipedia.org
No. Epithalamin is a peptide-containing extract of bovine pineal glands, while epitalon is a single synthetic tetrapeptide. The extract contains many peptides and other tissue components, so its composition varies between batches in ways that a synthesised sequence does not.
It is not recognised as an endogenous peptide hormone. The four-residue sequence can appear inside larger proteins and in digestive fragments of dietary protein, but no dedicated pathway producing it as a signalling molecule has been identified.
Several cell-culture reports describe increased telomerase activity after treatment, measured by enzyme assays or by transcript levels. Results differ between cell types and laboratories, and measured telomere lengthening has been reported in some studies but not in others, which leaves the physiological relevance open.
The dry powder is typically held at -20 degrees Celsius or lower, protected from light and moisture. Allowing a sealed vial to reach room temperature before opening reduces condensation on its contents. Conditions stated on a supplier certificate of analysis take precedence over general guidance.