The short version of Epithalamin fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-12-25 and is reviewed periodically as new material appears.
The published literature is dominated by a small number of research groups, much of it in Russian-language journals, and independent replication outside those groups is limited. Studies are typically small, use cultured cells or rodent models, and report endpoints that differ between papers, which makes comparison difficult. Large randomised human trials have not appeared in the indexed literature. Questions about absorption, distribution and clearance are therefore still treated as open in reviews that mention the compound.
Epitalon is a synthetic tetrapeptide with the sequence alanine–glutamate–aspartate–glycine, commonly abbreviated AEDG. Its design traces to epithalamin, a peptide fraction prepared from bovine pineal gland extracts that researchers in Saint Petersburg began investigating in the 1970s. The compound has a molecular formula of C14H22N4O9 and a nominal molecular mass near 390 daltons. It holds no approved drug status in the United States or the European Union, and material sold under this name is generally offered as a research chemical rather than a finished pharmaceutical product.
Stability depends strongly on pH, temperature and the presence of oxygen and trace metals. Cleavage of the backbone proceeds faster under neutral to alkaline conditions, whereas acidic solutions tend to slow that reaction. The aspartate and glutamate side chains can undergo deamidation or imide formation over time, generating closely related impurities. Published stability data specific to epitalon are sparse, so the usable life of a given solution is best regarded as an open question that depends on buffer composition, concentration and storage temperature.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography with ultraviolet detection, frequently near 214 nanometers where the peptide bond absorbs. Mass spectrometry, most often with electrospray ionization, confirms the observed molecular mass and helps separate the intact peptide from truncated or modified forms. Amino acid analysis or tandem mass spectrometry can establish residue order. Purity is commonly quoted as an area percentage, yet such values are method-dependent, and comparisons between laboratories require matching column, gradient and detection wavelength.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C14H22N4O9 | Synthetic tetrapeptide, four residues |
| Nominal mass | Approximately 390 Da | Free peptide; salt forms differ |
| Appearance | White to off-white powder | Commonly supplied lyophilised |
| Solubility class | Freely soluble in water | Also dissolves in aqueous buffer |
| Typical storage | −20 °C, desiccated | Cold packs used during transport |
In its supplied form epitalon is a white to off-white powder, usually lyophilized and often hygroscopic. It dissolves readily in water and in aqueous buffers, and it is commonly handled as the acetate or trifluoroacetate salt to improve stability during purification and drying. The amide backbone is labile in aqueous media, so solutions are less durable than the dry solid. Handling notes in the chemical literature therefore emphasize keeping the powder dry, cool and shielded from light until it is dissolved.
Epitalon is a synthetic tetrapeptide whose sequence is alanine-glutamate-aspartate-glycine, written in single-letter code as AEDG. The four residues are joined by three peptide bonds, giving a linear backbone with no branching and no disulfide bridges. Its calculated molecular mass for the free form is approximately 390.3 daltons, a figure that rises when the compound is supplied as an acetate or trifluoroacetate salt. Because the chain is short, the molecule is defined entirely by its residue order rather than by any folded three-dimensional structure.
Verification of research-grade material involves comparing a supplier chromatogram against an in-house reference, checking the observed mass against the calculated value, and where possible confirming residue order by tandem mass spectrometry or enzymatic peptide mapping. Purity claims should be read alongside the method used to obtain them, because detection wavelength and integration settings alter the result. Batch-specific data, rather than a generic grade statement, is the informative part of a certificate.
Identity and purity of epitalon samples are normally established by reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres, combined with mass spectrometry. The mass spectrum confirms the expected molecular ion and can reveal truncated or oxidised by-products. Amino acid analysis after acid hydrolysis verifies that the four residues are present in the expected ratio. Certificates typically report a purity figure taken from chromatographic peak area, expressed as a percentage of total integrated signal.
The peptide emerged from research carried out in Saint Petersburg from the late 1980s onward, where investigators searched for shorter active fragments of a pineal preparation known as epithalamin. The name epitalon was chosen to reflect that parent extract. Early reports described effects on neuroendocrine markers and on the lifespan of laboratory animals. Much of that work appeared in Russian-language journals, with English translations following later, which affects how readily the original protocols can be assessed by outside groups.
Published studies on epitalon are dominated by a small number of research groups, and independent replication in other laboratories remains limited. Proposed mechanisms include activation of telomerase and modulation of melatonin rhythms, but the evidence for either rests mainly on cell cultures and animal models. Whether the peptide produces comparable effects in humans is an open question, and the absence of large controlled trials means the literature is best read as exploratory rather than settled.
Epitalon is a synthetic four-amino-acid peptide with the sequence alanine-glutamate-aspartate-glycine, commonly abbreviated AEDG. Its molecular formula is C14H22N4O9, and its calculated molar mass is approximately 390.35 grams per mole. The compound is a short fragment related to a peptide fraction isolated from bovine pineal gland extracts, and it is normally supplied as a lyophilised powder intended for laboratory research. It is not a registered pharmaceutical product in most countries.
Short peptides such as AEDG are normally supplied as a freeze-dried solid and are kept dry, cold, and shielded from light. Holding at minus twenty degrees Celsius is common for the long term, while a refrigerator suffices for brief periods before use. The material takes up moisture to some degree, so containers should stay sealed and be allowed to reach room temperature before opening, which limits condensation on the contents. Repeated warming and cooling of a single container is discouraged because it admits water and can lower the amount of intact peptide.
Dissolution is usually performed in water or a suitable aqueous buffer, and the resulting liquid is divided into single-use portions before freezing. Freeze-thaw cycling is a recognised source of loss for short peptides, since each cycle can encourage aggregation or adsorption onto container walls. Working solutions are generally kept cold and used within a short window, although published stability data specific to epitalon are thin. Containers should be marked with concentration and date, and solutions examined for cloudiness before use.
Amphetamine also has a slight analgesic effect and can enhance the pain relieving effects of opioids. FDA-commissioned studies from 2011 indicate that in children, young adults, and adults there is no association between serious adverse cardiovascular events (sudden death, heart attack, and stroke) and the medical use of amphetamine or other ADHD stimulants. These findings were subsequently corroborated by a 2022 meta-analysis that sampled nearly four million participants, which found no association between therapeutic use of amphetamine and the development of cardiovascular disease in any age group. However, amphetamine pharmaceuticals are contraindicated in individuals with preexisting cardiovascular disease.
The white shark is an obligate ram ventilator; to breathe, it must swim constantly so water flows through its gills. Over 95% of the shark's musculature is white, fast-twitch muscles, which allows it to move in quick sprints, particularly when ambushing prey. The remaining dark, slow-twitch muscles carry oxygen to power the shark while at cruising speed. The white shark has a large, double-lobed liver that can be almost 30% of its body weight and stores lipids, fatty acids, and oils. The liver helps keep the shark from sinking, as the oil is six times more buoyant than the surrounding water. The lipids and fatty acids provide the shark with energy for travel and are important for reproduction and growth. One study concluded that a white shark liver is more energy-rich than whale blubber. White sharks appear to have strong immune systems and can tolerate high amounts of toxic heavy metals like mercury and arsenic in their blood, more so than many other vertebrates. They are also documented to heal relatively quickly from even severe wounds, and the species's genome shows "positive selection in key genes involved in the wound-healing process". White sharks use a system of blood vessels to warm up portions of their body (regional endothermy), which allows them to be active and hunt in cool waters. In this complex blood vessel system, known as a rete mirabile, warm blood generated from the dark muscles is constantly supplied to other parts of the body.
Chain brake A chain brake activator is located forward of the upper handle and is activated by a kickback event. When triggered, it tensions a band around the clutch drum, stopping the chain within milliseconds. A chain catcher is located between the saw body and the clutch cover. In most cases, it resembles a hook made of aluminum. It is used to stop the chain when it derails from the bar and shortens the length of the chain. When derailing, the chain swings from underneath the saw towards the operator. This prevents the chain from hitting the operator, which hits the rear handle guard instead. A rear handle guard protects the hand of the operator when the chain derails. Some chains have safety links, as on micro chisel saws. These links keep the saw close to the gap between two cutting links and lift the chain when the space at the safety link is full with saw chips, which lifts the chain and lets it cut slower. Nonprofessional chains have less aggressive teeth, by having shallower depth gauges.
On July 22, 2025, the United States informed of its decision to withdraw from UNESCO, effective December 31, 2026. In a presidential memorandum issued on January 7, 2026, Donald Trump directed to start the process of withdrawal of the US from the 66 organizations, agencies and commissions of the United Nations, including UN Framework Convention on Climate Change (UNFCCC), calling them "contrary to the interests of the United States".
Sources: en.wikipedia.org
NADPH oxidase (nicotinamide adenine dinucleotide phosphate oxidase) is a membrane-bound enzyme complex that faces the extracellular space. It can be found in the plasma membrane as well as in the membranes of phagosomes used by neutrophil white blood cells to engulf microorganisms. Human isoforms of the catalytic component of the complex include NOX1, NOX2, NOX3, NOX4, NOX5, DUOX1, and DUOX2.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Mostly containing a +5 species, which was immediately assigned to dubnium, it also had a +4 species; based on that result, the team decided that additional chemical separation was needed. In 2005, the experiment was repeated, with the final product being hydroxide rather than nitrate precipitate, which was processed further in both Livermore (based on reverse phase chromatography) and Dubna (based on anion exchange chromatography). The +5 species was effectively isolated; dubnium appeared three times in tantalum-only fractions and never in niobium-only fractions. It was noted that these experiments were insufficient to draw conclusions about the general chemical profile of dubnium. In 2009, at the JAEA tandem accelerator in Japan, dubnium was processed in nitric and hydrofluoric acid solution, at concentrations where niobium forms NbOF−4 and tantalum forms TaF−6. Dubnium's behavior was close to that of niobium but not tantalum; it was thus deduced that dubnium formed DbOF−4. From the available information, it was concluded that dubnium often behaved like niobium, sometimes like protactinium, but rarely like tantalum. In 2021, the volatile heavy group 5 oxychlorides MOCl3 (M = Nb, Ta, Db) were experimentally studied at the JAEA tandem accelerator. The trend in volatilities was found to be NbOCl3 > TaOCl3 ≥ DbOCl3, so that dubnium behaves in line with periodic trends.
On 5 January 2026, the Venezuelan government issued an emergency order to police to arrest anyone who supported the US attack and mobilized colectivos (pro-government paramilitaries) who established roadblocks and searched cars and people. Fourteen journalists were detained, but 13 of them were later released. On 6 January, gunfire broke out in Caracas as the ministry of communication announced that police fired upon one of their own military drones "flying without permission" but that the drone suffered no damage.
=== Industrial radiography === During World War II, Van de Graaff had used the compact generator invented with Trump to detect defects in ship hulls and ordnance for the U.S. Navy. Drawing on this application, HVEC produced 2-MeV industrial X-ray generators for non-destructive testing of manufactured goods. These units, capable of detecting flaws in thick steel sections, weighed more than two tons and were designed to operate in industrial facilities. HVEC adapted these generators to output electron beams, selling a line of industrial radiography equipment and also renting sterilization services to other companies. In 1957, Ethicon, a medical subsidiary of Johnson & Johnson, purchased an HVEC linear accelerator to sterilize surgical sutures, the first commercial medial product to use radiation processing. Sales of e-beam processing machines picked up after HVEC introduced insulating core transformers. ICTs, operating in the lower-voltage 300 keV to 2.5 MeV range, were used for crosslinking polyethylene and other polymers. W. R. Grace's Cryovac division used radiation crosslinking to produce heat-shrinkable materials for food packaging. Other companies purchased ICTs for extended to wire and cable insulation, rubber vulcanization, auto paint, textile modification, and semiconductors.
Sources: en.wikipedia.org
3,114km of high-pressure petroleum and gas pipelines An inland accumulation facility at Jameson Park, Gauteng (TM2), with a capacity of 180Ml A tank farm in Tarlton, Gauteng, for storage and distribution via rail and road, with a capacity of 29Ml A coastal terminal at Island View in Durban, for continuously supplying jet fuel to O.R. Tambo International Airport The Transnet pipeline network transports over 80% of refined fuel products for use in the inland market, and over 70% of the jet fuel used at O.R. Tambo International Airport. Approximately three-quarters of South Africa's fuel imports flow through Island View Precinct, which forms part of the Port of Durban. The Precinct serves as the country's main fuel storage and supply hub. Data for Transnet's pipeline fuel logistics is in the table below.
=== Hank Rizzoli === Hank Rizzoli (Ray Romano) is a photographer who is hired by the Braverman family for a family picture in season four. Sarah ultimately becomes Hank's assistant. While at first he disliked Sarah, the two begin a relationship that has problems as Sarah still has feelings for Mark Cyr. In season five, Hank begins a mentor-mentee relationship with Max and teaches him about photography. After spending time with Max, and reading a book about Asperger syndrome that Adam lent him (after one of Max's outbursts), Hank begins to realize that he shares many social qualities with Max and that he may have Asperger syndrome himself. Hank has a daughter, Ruby, from his previous marriage. When Amber is upset because Ryan York, her ex-fiancé, is involved in an accident, Hank offers to drive Amber the long distance to see Ryan. In season six, after Sarah and Hank move in together, Hank begins to bond with Amber and Drew. He helps Amber assemble her crib and asks Drew to be his best man. Hank and Sarah marry in the series finale.
Partial-thickness: The more common type involves removing a thin layer of skin from a healthy part of the body (the donor section). Full-thickness: Involves excising a defined area of skin, with a depth of excision down to the fat. The full thickness portion of skin is then placed at the recipient site. A full-thickness skin graft is more risky, in terms of the body accepting the skin, yet it leaves only a scar line on the donor section, similar to a Cesarean-section scar. In the case of full-thickness skin grafts, the donor section will often heal much more quickly than the injury and causes less pain than a partial-thickness skin graft. A partial thickness donor site must heal by re-epithelialization which can be painful and take an extensive length of time.
In the Philippines, public markets are managed by cooperatives according to legislation such as the Cooperatives Code (RA 7160) and the Agriculture and Fisheries Modernization Act (RA 8435). The Philippine government has control over the price of some commodities sold in palengkes, especially critical foods such as rice. In July 2017, the digital market Palengke Boy was launched in Davao City to compete against traditional markets. In March 2020, the Pasig local government launched a mobile market to ensure access to basic goods during the COVID-19 pandemic.
Reproductive Medicine: In 2024, a study demonstrated that SeV-mediated RNA delivery of the Kitl gene successfully re-initiated oogenesis and restored fertility in congenitally and chemotherapy-induced infertile female mice without genomic integration. Oncology: A 2024 study found that SeV provides more robust and consistent gene delivery into human pancreatic cancer cells than adeno-associated virus (AAV) or lentiviral vectors, regardless of tumor subtype. CRISPR-Cas9 Delivery: A next-generation "interferon-silent" and temperature-sensitive (ts) SeV platform was introduced in 2024, achieving over 90% editing efficiency in primary human hematopoietic stem and progenitor cells (HSPCs). In 2025, this ts SeV platform was further applied to deliver CRISPR/Cas9 for precise engineering of the human cytomegalovirus (HCMV) genome, bypassing traditional bacterial artificial chromosome (BAC) constraints and enabling editing in diverse cell types.
Sources: en.wikipedia.org
No. Epithalamin is a heterogeneous peptide fraction obtained from pineal gland extract and contains many components. Epitalon is a single synthetic tetrapeptide with the sequence Ala-Glu-Asp-Gly. Researchers synthesised the shorter peptide while attempting to identify active sequences within the extract.
No endogenous peptide with this exact sequence has been described as a circulating hormone or signalling molecule. The tetrapeptide was designed as a synthetic analogue based on fragments observed in pineal preparations. Any activity discussed in the literature therefore refers to administered material rather than to a natural pool of the compound.
It is not an approved medicine in major jurisdictions and does not appear in the major pharmacopoeias. Material is usually distributed as a research chemical or laboratory reagent. Such labelling places handling responsibility on the purchaser and does not indicate that a regulatory body has reviewed the substance.
The dry powder is typically held at -20 degrees Celsius or lower, protected from light and moisture. Allowing a sealed vial to reach room temperature before opening reduces condensation on its contents. Conditions stated on a supplier certificate of analysis take precedence over general guidance.