This is a working overview of AEDG, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2025-10-20. Anything still debated is marked as such rather than presented as settled.
Material supplied for laboratory use is normally a lyophilised white to off-white powder that dissolves readily in water and in isotonic saline. Lyophilised cakes are hygroscopic and should be equilibrated to room temperature before opening to limit condensation on the solid. Solutions are typically prepared at milligram-per-millilitre concentrations and divided into single-use aliquots, because repeated freeze–thaw cycles degrade short peptides. Aqueous solutions are far less stable than the dry powder, and identity is usually verified by mass spectrometry alongside purity estimation from reversed-phase high-performance liquid chromatography.
Epitalon is a synthetic linear tetrapeptide with the sequence alanine–glutamate–aspartate–glycine, abbreviated AEDG. Its molecular formula is C14H22N4O9 and the calculated mass is approximately 390.35 g/mol. The compound is made by solid-phase peptide synthesis rather than extracted from tissue, although early work described it as a short fragment of a peptide fraction obtained from bovine pineal extract. In the research literature the spelling epitalon and the variant epithalone both appear, while AEDG is the standard code used in peptide nomenclature.
Regulatory treatment differs by country. No formulation of epitalon holds a marketing authorisation as a medicine in the United States or the European Union, where material sold for laboratory use is handled as a research chemical and is not intended for human consumption. In Russia, several short peptide preparations from the same institute's peptide series are registered medicinal products, and epitalon appears in that national context. Elsewhere it is frequently offered as a cosmetic ingredient, a category with lighter requirements. Advertising claims about longevity or disease prevention are restricted in most jurisdictions, which limits how sellers describe the compound.
Freeze-dried epitalon is normally kept at minus twenty degrees Celsius in a sealed, desiccated container, protected from light. Short excursions at ambient temperature during shipping are generally tolerated, but repeated warming and cooling cycles encourage moisture uptake, which shortens shelf life. Once dissolved, the peptide is far less stable than the solid: aqueous solutions are subject to hydrolysis and to deamidation at the aspartate and glutamate residues. Working solutions are therefore held refrigerated and used within days, and repeated freezing and thawing of the same vial is best avoided.
Identity and purity are checked by reversed-phase high-performance liquid chromatography, usually with ultraviolet detection near 214 nanometres, where the peptide bond absorbs. Mass spectrometry confirms the expected mass and reveals whether truncation products or adducts are present. Acid hydrolysis followed by amino acid analysis gives the residue ratio, which should approximate one alanine, one glutamate, one aspartate and one glycine. Counter-ions such as acetate or trifluoroacetate remain in the dried product and lower net peptide content, so a stated purity figure on a label does not by itself describe how much peptide a vial holds.
| Property | Value | Notes |
|---|---|---|
| Amino acid sequence | Ala-Glu-Asp-Gly | Linear tetrapeptide, also written AEDG |
| Molecular mass | About 390.35 g/mol | Value calculated from the sequence |
| Appearance | White to off-white powder | Lyophilised material forms a loose cake |
| Solubility | Freely soluble in water | Also dissolves in isotonic saline |
| Storage | -20 °C, desiccated | Aliquot solutions to avoid freeze–thaw cycling |
The peptide is a synthetic analogue of epithalamin, a preparation extracted from bovine pineal glands. Investigators sought a short, chemically defined molecule that would reproduce some of the endocrine and gerontological observations attributed to the glandular extract. Proposed mechanisms centre on induction of telomerase activity, an effect reported in cultured human somatic cells in the early 2000s, together with influences on melatonin secretion and neuroendocrine regulation. Those mechanisms remain incompletely characterised, and the reported telomerase response has not been consistently reproduced by independent groups working in comparable systems.
Published work on this compound consists mainly of in vitro experiments, animal studies, and small clinical investigations, a substantial share of which appeared in Russian-language journals. Sample sizes are generally small, control conditions differ between studies, and several endpoints rely on markers whose clinical meaning is itself debated. Reviews of the longevity field treat the peptide as an early example of telomerase-directed research rather than an established intervention. Regulatory treatment varies by country: some jurisdictions place it under prescription controls, others treat it as a laboratory material, and importation may be restricted regardless of local status.
Epitalon is a synthetic tetrapeptide whose sequence is alanine–glutamate–aspartate–glycine, commonly abbreviated AEDG. It was developed in Russia during the 1980s and 1990s by investigators associated with the St. Petersburg Institute of Bioregulation and Gerontology, who studied short peptides as regulators of gene expression and tissue function. The alternative spelling epithalon appears interchangeably in the literature, and the two names refer to the same molecule. Outside Russia it is encountered chiefly as a research chemical rather than a licensed medicine, and it holds no approval from the United States Food and Drug Administration or the European Medicines Agency.
Documentation accompanying research peptides usually includes a certificate of analysis listing the batch number, purity figure, and test methods applied. Buyers comparing suppliers should check whether the reported purity refers to chromatographic area or to a mass-balance calculation, because the two are not equivalent. Counter-ion content, residual solvents, and water content are sometimes omitted from such certificates even though they affect the actual peptide mass present. Independent verification through a second laboratory is the most direct way to confirm that a supplied material matches its label.
Purity assessment of peptide reagents normally relies on reversed-phase high-performance liquid chromatography. A gradient of acetonitrile in water with trifluoroacetic acid, paired with a C18 stationary phase, separates the target tetrapeptide from truncated sequences and deletion analogues. Detection at 214 nanometres exploits absorbance of the peptide backbone, since the molecule contains no aromatic residue. Results are expressed as a percentage of total peak area. Values above ninety-five percent are typical for research-grade material, although reporting conventions vary between suppliers.
The compound is generally described as a synthetic analogue of a fragment isolated from a pineal gland extract. Researchers associated with the Saint Petersburg Institute of Bioregulation and Gerontology introduced it during the 1980s and 1990s while studying short peptides from animal tissue. The original extract, called epithalamin, is a heterogeneous mixture, whereas epitalon is a single defined sequence. That distinction matters because findings reported for the extract are not automatically findings about the pure tetrapeptide, and claims about broader biological effects remain a separate question from the chemical identity described here.
Residue composition is the property that most cleanly separates verified material from mislabelled samples. Alanine, glutamate, aspartate and glycine appear in that order from the N-terminus, and the two acidic residues sit in the middle of the chain. Because the peptide is short, it can be produced by solid-phase synthesis and characterised by mass spectrometry without ambiguity. Any reported sample whose measured mass departs substantially from 390 daltons is a different compound or a degraded mixture rather than epitalon.
Epitalon is a synthetic tetrapeptide whose four residues are alanine, glutamate, aspartate and glycine, commonly abbreviated AEDG. Its molecular formula is C14H22N4O9 and its monoisotopic mass is near 390.35 daltons. The peptide carries two acidic side chains, so it is neutral to negatively charged in most aqueous buffers. Published reference summaries usually list it under both spellings, epitalon and epithalon, and treat the two names as the same material.
==== Regulation in β cells ==== Glucose immediately amplifies glucokinase activity by the cooperativity effect. A second important rapid regulator of glucokinase activity in β cells occurs by direct protein-protein interaction between glucokinase and the "bifunctional enzyme" (phosphofructokinase-2/fructose-2,6-bisphosphatase), which also plays a role in the regulation of glycolysis. This physical association stabilizes glucokinase in a catalytically favorable conformation (somewhat opposite the effect of GKRP binding) that enhances its activity. In as little as 15 minutes, glucose can stimulate GCK transcription and glucokinase synthesis by way of insulin. Insulin is produced by the beta cells, but some of it acts on β cell B-type insulin receptors, providing an autocrine positive-feedback amplification of glucokinase activity. Further amplification occurs by insulin action (via A-type receptors) to stimulate its own transcription. Transcription of the GCK gene is initiated through the "upstream," or neuroendocrine, promoter. This promoter, in contrast to the liver promoter, has elements homologous to other insulin-induced gene promoters. Among the probable transacting factors are Pdx-1 and PPARγ. Pdx-1 is a homeodomain transcription factor involved in the differentiation of the pancreas. PPARγ is a nuclear receptor that responds to glitazone drugs by enhancing insulin sensitivity.
The National Liberals, as they were called by then, were gradually absorbed into the Conservative Party, finally merging in 1968. The official Liberals found themselves a tiny minority within a government committed to protectionism. Slowly they found this issue to be one they could not support. In early 1932 it was agreed to suspend the principle of collective responsibility to allow the Liberals to oppose the introduction of tariffs. Later in 1932 the Liberals resigned their ministerial posts over the introduction of the Ottawa Agreement on Imperial Preference. However, they remained sitting on the government benches supporting it in Parliament, though in the country local Liberal activists bitterly opposed the government. Finally in late 1933 the Liberals crossed the floor of the House of Commons and went into complete opposition. By this point their number of MPs was severely depleted. In the 1935 general election, just 17 Liberal MPs were elected, along with Lloyd George and three followers as independent Liberals. Immediately after the election the two groups reunited, though Lloyd George declined to play much of a formal role in his old party. Over the next ten years there would be further defections as MPs deserted to either the Liberal Nationals or Labour. Yet there were a few recruits, such as Clement Davies, who had deserted to the National Liberals in 1931 but now returned to the party during World War II and who would lead it after the war.
Oxidation and reduction reactions are not common in organic chemistry as few organic molecules can act as oxidizing or reducing agents. Iron(II), on the other hand, can easily be oxidized to iron(III). This functionality is used in cytochromes, which function as electron-transfer vectors. The presence of the metal ion allows metalloenzymes to perform functions such as redox reactions that cannot easily be performed by the limited set of functional groups found in amino acids. The iron atom in most cytochromes is contained in a heme group. The differences between those cytochromes lies in the different side-chains. For instance cytochrome a has a heme a prosthetic group and cytochrome b has a heme b prosthetic group. These differences result in different Fe2+/Fe3+ redox potentials such that various cytochromes are involved in the mitochondrial electron transport chain. Cytochrome P450 enzymes perform the function of inserting an oxygen atom into a C−H bond, an oxidation reaction.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Adult T-cell leukemia/lymphoma Angiocentric lymphoma (extranodal natural killer cell lymphoma, nasal-type NK lymphoma, NK/T-cell lymphoma, polymorphic/malignant midline reticulosis) Angioimmunoblastic T-cell lymphoma (angioimmunoblastic lymphadenopathy with dysproteinemia) Blastic NK-cell lymphoma CD30+ cutaneous T-cell lymphoma (primary cutaneous anaplastic large cell lymphoma) Cutaneous lymphoid hyperplasia (borrelial lymphocytoma, lymphadenosis benigna cutis, lymphocytoma cutis, pseudolymphoma, pseudolymphoma of Spiegler and Fendt, sarcoidosis of Spiegler and Fendt, Spiegler–Fendt lymphoid hyperplasia, Spiegler–Fendt sarcoid) Cutaneous lymphoid hyperplasia with bandlike and perivascular patterns Cutaneous lymphoid hyperplasia with nodular pattern (nodular pattern of cutaneous lymphoid hyperplasia) Diffuse large B-cell lymphoma (primary cutaneous large B-cell lymphoma) Granulocytic sarcoma (chloroma, myeloid sarcoma) Granulomatous slack skin Hairy-cell leukemia Hodgkin's disease Ichthyosis acquisita (acquired ichthyosis) IgG4-related skin disease Intravascular large B-cell lymphoma (angiotropic large cell lymphoma, intralymphatic lymphomatosis, intravascular lymphomatosis, malignant angioendotheliomatosis) Jessner lymphocytic infiltrate of the skin (benign lymphocytic infiltration of the skin, Jessner lymphocytic infiltration of the skin, Jessner–Kanof lymphocytic infiltration of the skin, lymphocytic infiltrate of Jessner) Kikuchi's disease (histiocytic necrotizing lymphadenitis) Large plaque parapsoriasis (parapsoriasis en plaques) Lennert lymphoma (lymphoepitheliod lymphoma) Leukemia cutis Lymphoma cutis Lymphomatoid granulomatosis Lymphomatoid papulosis Malignant histiocytosis (histiocytic medullary reticulosis) Marginal zone B-cell lymphoma Mucosa-associated lymphoid tissue lymphoma Mycosis fungoides Non-mycosis fungoides CD30− cutaneous large T-cell lymphoma Nonspecific cutaneous conditions associated with leukemia (leukemid) Pagetoid reticulosis (acral mycoses fungoides, localized epidermotropic reticulosis, mycosis fungoides palmaris et plantaris, unilesional mycosis fungoides, Woringer–Kolopp disease) Pityriasis lichenoides chronica (chronic guttate parapsoriasis, chronic pityriasis lichenoides, dermatitis psoriasiformis nodularis, parapsoriasis chronica, parapsoriasis lichenoides chronica) Pityriasis lichenoides et varioliformis acuta (acute guttate parapsoriasis, acute parapsoriasis, acute pityriasis lichenoides, Mucha–Habermann disease, parapsoriasis acuta, parapsoriasis lichenoides et varioliformis acuta, parapsoriasis varioliformis) Plasmacytoma Plasmacytosis Pleomorphic T-cell lymphoma (non-mycosis fungoides CD30− pleomorphic small/medium-sized cutaneous T-cell lymphoma) Polycythemia vera (erythremia) Primary cutaneous follicular lymphoma (follicular center cell lymphoma, follicular center lymphoma) Primary cutaneous immunocytoma Primary cutaneous marginal zone lymphoma Retiform parapsoriasis Secondary cutaneous CD30+ large cell lymphoma Sézary syndrome Sinus histiocytosis with massive lymphadenopathy (Rosai–Dorfman disease) Subcutaneous T-cell lymphoma (panniculitis-like T-cell lymphoma) Vesiculopustular eruption and leukemoid reaction in Down syndrome
Sources: en.wikipedia.org
== Signs and symptoms == ED is characterized by the persistent or recurring inability to achieve or maintain an erection of the penis with sufficient rigidity and duration for satisfactory sexual activity. It is defined as the "persistent or recurrent inability to achieve and maintain a penile erection of sufficient rigidity to permit satisfactory sexual activity for at least 3 months."
=== „Gott ist schön“ (Dissertation 1998) === A parallel (including excursions into the scholarly realm) is discernable here with Kermani's narratively oriented 1999 dissertation „Gott ist schön“ (God is Beautiful). The dissertation, after all, investigates the (musical) aesthetics of the Koran and contains a subchapter entitled “Those Killed by the Koran“.
Isobaric labeling is a mass spectrometry strategy used in quantitative proteomics. Peptides or proteins are labeled with chemical groups that have nominally identical mass (isobaric), but vary in terms of distribution of heavy isotopes in their structure. These tags, commonly referred to as tandem mass tags, are designed so that the mass tag is cleaved at a specific linker region upon high-energy collision-induced dissociation (HCD) during tandem mass spectrometry yielding reporter ions of different masses. The most common isobaric tags are amine-reactive tags. However, tags that react with cysteine residues and carbonyl groups have also been described. These amine-reactive groups go through N-hydroxysuccinimide (NHS) reactions, which are based around three types of functional groups. Isobaric labeling methods include tandem mass tags (TMT), isobaric tags for relative and absolute quantification (iTRAQ), mass differential tags for absolute and relative quantification, and dimethyl labeling. TMTs and iTRAQ methods are most common and developed of these methods. Tandem mass tags have a mass reporter region, a cleavable linker region, a mass normalization region, and a protein reactive group and have the same total mass.
Gavi's main objective is vaccination programs. Gavi has been the main funder of vaccination in low and middle income countries. In 2012, the first Médecins Sans Frontières (MSF) "The right shot" report criticized Gavi for focusing on funding expensive new vaccines and neglecting to give children low-cost older ones. "Twenty percent of the world's children aren't even getting the basic vaccines", MSF's vaccine policy adviser said. MSF criticized the Global Vaccine Action Plan (GVAP), a WHO global collaboration of which Gavi is listed as a leader, as flawed for failing to help those 20%, which is some 19 million infants.
Sources: en.wikipedia.org
It is a synthetic tetrapeptide. Its sequence was derived from research on peptide fractions of bovine pineal extract, and the intact AEDG sequence has not been demonstrated as an abundant free peptide in human tissue.
AEDG is the one-letter code for the four amino acids alanine, glutamate, aspartate and glycine in that order. The same molecule is written in three-letter form as Ala-Glu-Asp-Gly.
Identity is normally confirmed by mass spectrometry against the calculated mass of roughly 390.35 g/mol. Purity is then estimated by reversed-phase high-performance liquid chromatography with ultraviolet detection.
The solid is kept cold, dry and dark, typically at minus twenty degrees Celsius, in a sealed container with desiccant. Dissolved material is kept refrigerated and used promptly. Freezing and thawing a solution repeatedly is avoided because it accelerates degradation.