A practical reference on tetrapeptide: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-11-14. Anything still debated is marked as such rather than presented as settled.
The peptide is a synthetic analogue of epithalamin, a preparation extracted from bovine pineal glands. Investigators sought a short, chemically defined molecule that would reproduce some of the endocrine and gerontological observations attributed to the glandular extract. Proposed mechanisms centre on induction of telomerase activity, an effect reported in cultured human somatic cells in the early 2000s, together with influences on melatonin secretion and neuroendocrine regulation. Those mechanisms remain incompletely characterised, and the reported telomerase response has not been consistently reproduced by independent groups working in comparable systems.
Published work on this compound consists mainly of in vitro experiments, animal studies, and small clinical investigations, a substantial share of which appeared in Russian-language journals. Sample sizes are generally small, control conditions differ between studies, and several endpoints rely on markers whose clinical meaning is itself debated. Reviews of the longevity field treat the peptide as an early example of telomerase-directed research rather than an established intervention. Regulatory treatment varies by country: some jurisdictions place it under prescription controls, others treat it as a laboratory material, and importation may be restricted regardless of local status.
Residue composition is the property that most cleanly separates verified material from mislabelled samples. Alanine, glutamate, aspartate and glycine appear in that order from the N-terminus, and the two acidic residues sit in the middle of the chain. Because the peptide is short, it can be produced by solid-phase synthesis and characterised by mass spectrometry without ambiguity. Any reported sample whose measured mass departs substantially from 390 daltons is a different compound or a degraded mixture rather than epitalon.
Epitalon is a synthetic tetrapeptide whose four residues are alanine, glutamate, aspartate and glycine, commonly abbreviated AEDG. Its molecular formula is C14H22N4O9 and its monoisotopic mass is near 390.35 daltons. The peptide carries two acidic side chains, so it is neutral to negatively charged in most aqueous buffers. Published reference summaries usually list it under both spellings, epitalon and epithalon, and treat the two names as the same material.
The compound is generally described as a synthetic analogue of a fragment isolated from a pineal gland extract. Researchers associated with the Saint Petersburg Institute of Bioregulation and Gerontology introduced it during the 1980s and 1990s while studying short peptides from animal tissue. The original extract, called epithalamin, is a heterogeneous mixture, whereas epitalon is a single defined sequence. That distinction matters because findings reported for the extract are not automatically findings about the pure tetrapeptide, and claims about broader biological effects remain a separate question from the chemical identity described here.
| Property | Value | Notes |
|---|---|---|
| Peptide sequence | Ala-Glu-Asp-Gly | Often abbreviated AEDG in research literature |
| Common synonyms | Epithalon, epitalon, AEDG | Spelling variants refer to the same tetrapeptide |
| Molecular formula | C14H22N4O9 | Theoretical monoisotopic mass near 390.35 Da |
| Appearance | White to off-white powder | Typically supplied as a lyophilised solid |
| Solubility class | Freely soluble in water | Hydrophilic peptide; dissolves in aqueous buffer |
The compound is described in the literature as a derivative of epithalamin, a preparation obtained from bovine pineal tissue. Work on this peptide family was carried out mainly by a research group in Saint Petersburg beginning in the 1980s, and the substance was later registered for clinical use in Russia under the name Epitalon. Outside that region it is generally treated as a research chemical rather than an approved medicine. Statements about its biological activity rest on a relatively small number of studies, and independent replication remains limited.
In its supplied form epitalon is a white to off-white powder, usually lyophilized and often hygroscopic. It dissolves readily in water and in aqueous buffers, and it is commonly handled as the acetate or trifluoroacetate salt to improve stability during purification and drying. The amide backbone is labile in aqueous media, so solutions are less durable than the dry solid. Handling notes in the chemical literature therefore emphasize keeping the powder dry, cool and shielded from light until it is dissolved.
Material supplied for laboratory use is normally a lyophilised white to off-white powder that dissolves readily in water and in isotonic saline. Lyophilised cakes are hygroscopic and should be equilibrated to room temperature before opening to limit condensation on the solid. Solutions are typically prepared at milligram-per-millilitre concentrations and divided into single-use aliquots, because repeated freeze–thaw cycles degrade short peptides. Aqueous solutions are far less stable than the dry powder, and identity is usually verified by mass spectrometry alongside purity estimation from reversed-phase high-performance liquid chromatography.
Epitalon is a synthetic linear tetrapeptide with the sequence alanine–glutamate–aspartate–glycine, abbreviated AEDG. Its molecular formula is C14H22N4O9 and the calculated mass is approximately 390.35 g/mol. The compound is made by solid-phase peptide synthesis rather than extracted from tissue, although early work described it as a short fragment of a peptide fraction obtained from bovine pineal extract. In the research literature the spelling epitalon and the variant epithalone both appear, while AEDG is the standard code used in peptide nomenclature.
=== Sydney Graham === Sydney Graham (Savannah Paige Rae) is Julia and Joel's daughter, and is five years old in the first season. With Joel at home with her full-time, Sydney has become a "daddy's girl," which causes Julia anxiety about finding significant bonding time with her little girl. She has been identified as being gifted. In the fourth season, she begins to have jealous feelings towards her new brother, Victor, when she feels that he's getting more attention from their parents. In the sixth season, she is accused of "bullying" at school (likely due to the uncertainty of whether or not her parents will get back together), has a generally bad attitude, and gives an insincere apology to the girl she allegedly excludes.
=== Entomotherapy: Nutritional and Medicinal Benefits === Insects have played a significant role in traditional and modern medicine across various cultures. The Food and Agriculture Organization (FAO) Edible Insects Report highlights the nutritional and therapeutic potential of insects, they have high protein content, essential fatty acids, and bioactive compounds. Some traditional healing practices incorporate insects as remedies for inflammatory conditions, infections, and gastrointestinal disorders. In China and other parts of Asia silkworm derived compounds have been used in traditional medicine to treat high blood pressure and atherosclerosis. Similarly termites and grasshoppers are utilized in African medicine for their perceived immune boosting effects.
In the catabolism of uracil, the enzyme converts uracil to dihydrouracil using nicotinamide adenine dinucleotide phosphate (NADPH) as its cofactor. It can also act on thymine to give dihydrothymine. In humans the enzyme is encoded by the DPYD gene. It is the initial and rate-limiting step in pyrimidine catabolism. It is also involved in the degradation of the chemotherapeutic drugs 5-fluorouracil and tegafur. It participates in beta-alanine metabolism and pantothenate and coa biosynthesis.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Another effect is the spin–orbit interaction, particularly spin–orbit splitting, which splits the 6d subshell—the azimuthal quantum number ℓ of a d shell is 2—into two subshells, with four of the ten orbitals having their ℓ lowered to 3/2 and six raised to 5/2. All ten energy levels are raised; four of them are lower than the other six. (The three 6d electrons normally occupy the lowest energy levels, 6d3/2.) A singly ionized atom of dubnium (Db+) should lose a 6d electron compared to a neutral atom; the doubly (Db2+) or triply (Db3+) ionized atoms of dubnium should eliminate 7s electrons, unlike its lighter homologs. Despite the changes, dubnium is still expected to have five valence electrons. As the 6d orbitals of dubnium are more destabilized than the 5d ones of tantalum, and Db3+ is expected to have two 6d, rather than 7s, electrons remaining, the resulting +3 oxidation state is expected to be unstable and even rarer than that of tantalum. The ionization potential of dubnium in its maximum +5 oxidation state should be slightly lower than that of tantalum and the ionic radius of dubnium should increase compared to tantalum; this has a significant effect on dubnium's chemistry. Atoms of dubnium in the solid state should arrange themselves in a body-centered cubic configuration, like the previous group 5 elements. The predicted density of dubnium is 21.6 g/cm3.
Sources: en.wikipedia.org
=== EURATOM === The European Atomic Energy Community (EURATOM) was founded on March 25, 1957, by the Treaty of Rome between France, Italy, the Benelux countries and the Federal Republic of Germany, and remains almost unchanged to this day. Chapter 3 of the Euratom Treaty regulates measures to protect the health of the population. Article 35 requires facilities for the continuous monitoring of soil, air and water for radioactivity. As a result, monitoring networks have been set up in all Member States and the data collected is sent to the EU's central database (EURDEP, European Radiological Data Exchange Platform). The platform is part of the EU's ECURIE system for the exchange of information in the event of radiological emergencies and became operational in 1995. Switzerland also participates in this information system.
Label-free quantification is a method in mass spectrometry that aims to determine the relative amount of proteins in two or more biological samples. Unlike other methods for protein quantification, label-free quantification does not use a stable isotope containing compound to chemically bind to and thus label the protein.
== Objective == Grameen Danone Foods aims to reduce poverty by creating business and employment opportunities for local people since raw materials including milk needed for production, will be sourced locally. The companies that make up Grameen Danone Foods Ltd. have agreed not to take out any of the profits out of the company. Instead they will invest these for creation of new opportunities for the welfare and development of people. Hence it is called 'social business enterprise'.
==== 24 Hour Jungle Ration (no longer available) ==== The 24 Hour Jungle ration is based on the standard 24 Hour ration with additional supplements and a Flameless Ration Heater (FRH). The Jungle ration is designed for use by the special forces and other specialist units. The 24 Hour Jungle Ration provides a minimum of 4500 kcals (18,840 kJ) a day.
Sources: en.wikipedia.org
Epitalon is a synthetic four-amino-acid peptide with the sequence alanine–glutamate–aspartate–glycine, also written AEDG. It was developed in Russian gerontology research and is studied for proposed effects on telomerase, melatonin regulation, and neuroendocrine function. It is not an approved pharmaceutical in the United States or the European Union.
No. Epithalamin is a peptide-rich extract prepared from bovine pineal glands, while epitalon is a short synthetic peptide designed as a defined analogue of it. The synthetic version was intended to provide a reproducible molecule with some of the same proposed biological activity.
Telomere elongation and telomerase activation have been reported in cultured human somatic cells, but evidence from living human subjects is limited and has not been independently confirmed at scale. Reported findings come largely from small studies with differing designs, so the question remains open rather than settled.
It is a four-amino-acid peptide built from alanine, glutamate, aspartate and glycine in that order. Its formula is C14H22N4O9, and it is made by chemical synthesis rather than extracted from tissue. The synthetic peptide is a single defined molecule, unlike the pineal extracts it is often compared with.