Everything below concerns Tetrapeptide. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2025-11-27. Where a claim depends on a specific study, the study is described rather than over-claimed.
Epitalon is a synthetic tetrapeptide with the residue sequence alanine-glutamate-aspartate-glycine, commonly abbreviated AEDG. Its monoisotopic mass is approximately 390.35 daltons, and it is usually supplied as a lyophilised trifluoroacetate or acetate salt. The compound was derived from a pineal gland extract called epithalamin, a heterogeneous preparation investigated in the former Soviet Union. Researchers associated with the Saint Petersburg Institute of Bioregulation and Gerontology described the tetrapeptide as a constituent fragment of that extract. Commercial material is offered as a laboratory reagent rather than as a finished pharmaceutical product.
Literature searches for this compound must account for several spelling variants. Indexing databases contain epitalon, epithalon, epithalone, and AEDG, and relevant records are scattered across Russian-language and English-language journals that do not consistently cross-cite. Early publications describe the parent extract as a mixture of many peptides, whereas later work addresses the single synthetic tetrapeptide. That shift in nomenclature complicates comparison between studies, because extract data and tetrapeptide data are sometimes cited interchangeably. A search strategy omitting the alternate spellings will return an incomplete set of references.
The most frequently cited proposed action is induction of telomerase, the enzyme that adds repeat sequences to chromosome ends. Cell-culture work from the originating group reported higher telomerase reverse transcriptase expression and measurable telomere elongation in human somatic cells after exposure. How a four-residue peptide would reach nuclear gene regulation is not established, and no cell-surface receptor or uptake route has been identified. Additional reports describe changes in melatonin secretion, antioxidant enzyme activity and lipid peroxidation in aged animals, but these findings remain mechanistically unconnected to the telomerase observation.
Published evidence comes mainly from Russian-language journals and from a single research group, with small sample sizes and limited independent replication. A few laboratories outside that group have examined related peptides and reported weaker or absent telomerase effects, so the central claim is best described as contested rather than settled. Rodent studies report modest changes in some ageing markers and in survival, but designs vary and control conditions are often sparse. No large randomised trial in humans has been published, and long-term safety data in healthy populations are correspondingly thin.
Epitalon is a synthetic tetrapeptide with the sequence alanine-glutamate-aspartate-glycine, commonly abbreviated AEDG. It was designed at the St. Petersburg Institute of Bioregulation and Gerontology as a short, chemically defined analogue of epithalamin, a fraction obtained from bovine pineal tissue. Small peptide bioregulators of this type formed a long-running line of work there from the 1980s onward. Because the molecule is produced by solid-phase synthesis rather than extraction, its composition is exact and its purity can be measured directly.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic tetrapeptide | Four amino acid residues |
| Residue sequence | Ala-Glu-Asp-Gly | Abbreviated AEDG |
| Approximate mass | 390.35 Da | Monoisotopic, free base form |
| Parent preparation | Epithalamin extract | Derived from pineal tissue |
| Common spelling variants | Epithalon, epithalone, AEDG | Affects literature retrieval |
The published literature is dominated by a small number of research groups, much of it in Russian-language journals, and independent replication outside those groups is limited. Studies are typically small, use cultured cells or rodent models, and report endpoints that differ between papers, which makes comparison difficult. Large randomised human trials have not appeared in the indexed literature. Questions about absorption, distribution and clearance are therefore still treated as open in reviews that mention the compound.
Epitalon is a synthetic tetrapeptide with the sequence alanine–glutamate–aspartate–glycine, commonly abbreviated AEDG. Its design traces to epithalamin, a peptide fraction prepared from bovine pineal gland extracts that researchers in Saint Petersburg began investigating in the 1970s. The compound has a molecular formula of C14H22N4O9 and a nominal molecular mass near 390 daltons. It holds no approved drug status in the United States or the European Union, and material sold under this name is generally offered as a research chemical rather than a finished pharmaceutical product.
Laboratory work has examined effects on telomerase activity in cultured cells, on melatonin rhythms in animals, and on markers of oxidative stress. Some experiments report measurable changes while others show none, and the reported findings rest largely on small studies. The absence of large independent trials means the generality of these results is unresolved rather than settled. Review articles occasionally apply the label geroprotector, a term that reflects a research hypothesis about ageing rather than an established clinical finding.
Epitalon is the common name for a synthetic tetrapeptide with the sequence alanine-glutamate-aspartate-glycine, usually abbreviated AEDG. All four residues are proteinogenic amino acids, and the free peptide has a calculated mass near 390 grams per mole. Because the chain is short and carries no modifications, it is assembled readily by solid-phase synthesis and is distributed mainly as a freeze-dried solid for laboratory work. Catalogue listings use the spellings epitalon, epithalone, and simply AEDG, and the three refer to the same sequence.
A honey bee that is away from the hive foraging for nectar or pollen will rarely sting, except when stepped on or roughly handled. Honey bees will actively seek out and sting when they perceive the hive to be threatened, often being alerted to this by the release of attack pheromones (below). Although it is widely believed that a worker honey bee can sting only once, this is only partially true: although the stinger is in fact barbed so that it lodges in the victim's skin, tearing loose from the bee's abdomen and leading to its death in minutes, this only happens if the skin of the victim is sufficiently thick, such as a mammal's. Honey bees are the only hymenoptera with a strongly barbed sting, though yellow jackets and some other wasps have small barbs. The venom of the honeybee contains histamine, mast cell degranulating peptide, melittin, phospholipase A2, hyaluronidase and acid phosphatase. The three proteins in honeybee venom that are important allergens are phospholipase A2, hyaluronidase and acid phosphatase. In addition, the polypeptide melittin is also antigenic. Bumblebee venom appears to be chemically and antigenically related to honeybee venom. Bees with barbed stingers can often sting other insects without harming themselves. Queen honeybees and bees of many other species, including bumblebees and many solitary bees, have smoother stingers with smaller barbs and can sting mammals repeatedly. The sting's injection of apitoxin into the victim is accompanied by the release of alarm pheromones, a process which is accelerated if the bee is fatally injured.
There are similar check valves where the disc is not a ball, but some other shape, such as a poppet energized by a spring. Ball check valves should not be confused with ball valves, which are a different type of valve in which a ball rotating on a pin acts as a controllable rotor to stop or direct flow.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
== External links == "Melanocortin Receptors: MC3". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical Pharmacology. This article incorporates text from the United States National Library of Medicine, which is in the public domain.
Sources: en.wikipedia.org
=== Growth-related === TCTP has properties of a tubulin binding protein that associates with microtubules in a cell cycle-dependent manner. The transient overexpression of TCTP in HeLa cells prevented them from undergoing etoposide-induced apoptosis. Expressing TCTP in U2OS (human bone osteosarcoma epithelial cells) protected them from cell death induced by etoposide over various concentrations and durations of exposure. TCTP overexpression inhibited caspase-3-like activity as assessed by the cleavage of fluorogenic substrate. Expression levels of TCTP were down-regulated at the mRNA and protein levels during tumor suppression and by the activation of p53 and Siah-1 very well known anti-tumor genes. Down-regulation of TCTP can induce tumor reversion, and in combination with some drugs that decrease the level of TCTP and will lead to kill tumor cells. TCTP knockdown in primary mammary tumor cells, results in increased p53 expression and a decreased number of stem-like cancer cells. Reducing TCTP (dTCTP) levels in Drosophila reduces cell size, cell number and organ size, which mimics Drosophila Rheb (dRheb) mutant phenotypes; human TCTP (hTCTP) shows similar biochemical properties compared to dTCTP.
== Description == Among the distinguishing characters of the genus are two series of stamens totaling twice the number of petals; free or nearly free petals (not joined in a tube); a stout rhizome from whose axils the flowering stems rise; and a basal rosette of leaves. This genus contains the only species of Crassulaceae that have unisexual flowers.
Arsène Wenger management career statistics at Soccerbase Arsène Wenger manager profile at J.League (archive) (in Japanese) Arsène Wenger profile at Arsenal.com Arsène Wenger at Soccerway.com Arsène Wenger at WorldFootball.net Arsène Wenger at Soccerbase.com (manager) Arsène Wenger at J.League (manager) (in Japanese) Arsène Wenger at L'Équipe (in French)
=== Low-intensity conflict (8 April – 24 May) === On 8 April, the Taliban-run Afghan foreign ministry stated that talks with Pakistani officials in China had concluded and described the discussions as constructive. Chinese officials said that representatives of Pakistan and the Taliban had agreed to work toward an early easing of tensions and to avoid actions that could escalate the situation. Pakistani officials did not comment on the outcome of talks. On the same day, Amir Khan Muttaqi, the Taliban's foreign minister, said while meeting with diplomats from Central Asian states that the group would not permit Afghan territory to be used by any group to threaten neighboring states. Although he did not name any organisation, he said the presence of such elements anywhere was unacceptable and that the Taliban intended to deal with the matter. He also stated that the Taliban were committed to easing tensions with Pakistan through dialogue and said he hoped the talks would produce positive outcomes. However, on 9 April, Mohammad Naeem Wardak, the Taliban's deputy foreign minister, said that talks between Pakistani and Taliban officials in China had ended without agreement and attributed their failure to Pakistani officials. On 10 April, local elders in Kunar and Nuristan said that Taliban border forces had withdrawn from several border posts in Bari Kot in Nari district, Kunar, and in Kamdesh district, Nuristan, and had taken shelter in village mosques.
In February 2023, President Lula said he was planning to visit Angola, Mozambique and South Africa, and that Brazil should "repay its historical, cultural debt with Africa" through strengthening scientific and technological assistance to African nations.
Sources: en.wikipedia.org
=== Integrin inside-out signaling === Immunologists had initially pushed back against the idea that the adhesion molecules discovered by Springer could contribute to antigen-specific recognition, as they were thought to prevent antigen-specificity. In a major conceptual advance, Dustin and Springer discovered that adhesiveness of LFA-1 on T cells is regulated. They showed that LFA-1 is inactive until other cell surface receptors are stimulated. The initial demonstration was with T cell antigen receptor stimulation and pharmacologic stimulation of protein kinases. Intracellular tyrosine kinases are downstream from the T cell receptor and receptor tyrosine kinases and G protein coupled receptors are now known to be equally effective. The process was termed “inside-out signaling” and explained how adhesion receptors can cooperate with and amplify antigen recognition without abolishing immune specificity. It occurred without any change in LFA-1 density on the cell surface, suggesting that conformational change might be involved, stimulating Springer to become a structural biologist. Some thought that binding of adaptors such as talin was sufficient for inside-out signaling. However, force transmitted by the actin cytoskeleton through adaptors to integrins that is resisted by integrin-bound ligands embedded in the extracellular environment is also required and essential for ultrasensitivity. Furthermore, all stimulators of integrin inside-out signaling stimulate actin polymerization.
Released in May 2016, Battleborn was a cooperative first-person shooter video game with multiplayer online battle arena (MOBA) elements. Battleborn takes place in a space fantasy setting where multiple races contest possession of the universe's last star. Players select one of multiple pre-defined heroes, customized with passive abilities gained through end-of-mission loot, to complete both player-vs-player and player-vs-environment events. During such events, characters are leveled up through their "Helix tree", granting one of two abilities at each level. It was released within a month of Blizzard Entertainment's Overwatch, a hero shooter with similar concepts, and which quickly overshadowed Battleborn. The title went free-to-play in June 2017 and was shut down in January 2021.
== A conceptual shift to intracrinology from endocrinology == The field of intracrinology was introduced about 40 years ago and is only now gaining widespread recognition. This shift has been driven by overwhelming evidence that many cells, beyond the traditionally recognized endocrine organs, can synthesize, metabolize, and regulate their own sex hormones. This paradigm challenges the traditional endocrine model, which held that sex steroid production and regulation occur primarily in the gonads. Intracrinology has transformed our understanding of tissue autonomy, emphasizing how local hormone production enables precise, cell-specific regulation of physiological processes. This perspective has had profound implications for rheumatology, oncology, and metabolic research, where local steroidogenesis influences disease progression and treatment responses.
methods of recruitment to civil services and for civil posts making appointments to civil services and posts making promotions and transfers from one service to another The suitability of candidates for such appointments, promotions, or transfers On all disciplinary matters against a civil servant serving in a civil capacity, including memorials or petitions relating to such matters. On any claim by or in respect of a person who is serving or has served in a civil capacity, that any costs incurred in defending legal proceedings instituted against him in respect of acts done or purporting to be done in the execution of their duty should be paid out of the Consolidated Fund of India. On any claim for the award of a pension in respect of injuries sustained by a person while serving in a civil capacity, and any question as to the amount of such award. It shall be the duty of a Union Public Service Commission to advise on any matter referred to them; provided that the President has not made any regulations specifying the matters in which it shall not be necessary for the Union Public Service Commission to be consulted.
Octopus vulgaris grows to 25 cm (10 inches) in mantle length with arms up to 1 m (3.3 feet) long. It lives for 1–2 years and may weigh up to 9 kg (20 pounds). Mating may become cannibalistic. O. vulgaris is caught by bottom trawls on a huge scale off the northwestern coast of Africa. More than 20,000 tonnes (22,000 short tons) are harvested annually. The common octopus hunts at dusk. Crabs, lobsters, and bivalve mollusks (such as cockles) are preferred, although the octopus eats almost anything it can catch. It is able to change colour to blend in with its surroundings, and is able to jump upon any unwary prey that wanders across its path. Using its beak, it is able to break into the shells of shelled mollusks. It also possesses venom to subdue its prey. They have evolved to have large nervous systems and brains. An individual has about 500 million neurons in its body, almost comparable to dogs. They are intelligent enough to distinguish brightness, navigate mazes, recognize individual people, learn how to unscrew a jar or raid lobster traps. They have also been observed keeping "gardens", in which they collect various marine plant life and algae, alongside collections of shells and rocks; this behavior may have inspired the 1969 Beatles title, "Octopus' Garden". O. vulgaris was the first invertebrate animal protected by the Animals (Scientific Procedures) Act 1986 in the UK. Training experiments have shown the common octopus can distinguish the brightness, size, shape, and horizontal or vertical orientation of objects.
Sources: en.wikipedia.org
It is based on epithalamin, a peptide-rich preparation obtained from pineal gland tissue and studied in the former Soviet Union. Researchers later identified the tetrapeptide AEDG as a constituent fragment of that material. Modern supplies are produced by chemical synthesis rather than tissue extraction.
No. Epithalamin is a heterogeneous extract containing many peptides, while epitalon is a single synthesised tetrapeptide. Publications sometimes treat findings from the two as equivalent, which is a common source of confusion. Their compositions differ and they are not interchangeable in analytical terms.
Most published work uses cell cultures or rodents because those models are faster and less costly to run. The few human trials that have been reported are small, and several lack control groups or blinding. This restricts what can reasonably be concluded about effects in people.
No. Epithalamin is a peptide-containing extract of bovine pineal glands, while epitalon is a single synthetic tetrapeptide. The extract contains many peptides and other tissue components, so its composition varies between batches in ways that a synthesised sequence does not.